Recombinant Human Histone H2B type 1-C/E/F/G/I (HIST1H2BC), partial

Product Description

Recombinant Human Histone H2B type 1-C/E/F/G/I (HIST1H2BC), partial is available at Gentaur for Next week Delivery.

Gene Name: HIST1H2BC

Alternative Names : Histone H2B.1 AHistone H2B.a;H2B/aHistone H2B.g;H2B/gHistone H2B.h;H2B/hHistone H2B.k;H2B/kHistone H2B.l;H2B/l

Expression Region : 2-125aa

AA Sequence : PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 40.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a tplate. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome rodeling.Has broad antibacterial activity. May contribute to the formation of the functional antimicrobial barrier of the colonic epithelium, and to the bactericidal activity of amniotic fluid.

Function : Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.; FUNCTION

Involvement in disease :

Subcellular location : Nucleus, Chromosome

Protein Families : Histone H2B family

Tissue Specificity :

Paythway :

Uniprot ID : P62807