Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain (HLA-A), partial

Product Description

Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain (HLA-A), partial is available at Gentaur for Next week Delivery.

Gene Name: HLA-A

Alternative Names : MHC class I antigen A*1 HLAA

Expression Region : 25-308aa

AA Sequence : GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 36.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the presentation of foreign antigens to the immune system.

Function : Involved in the presentation of foreign antigens to the immune system.

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families : MHC class I family

Tissue Specificity :

Paythway : Cellularsenescence

Uniprot ID : P30443