Recombinant Human Homeobox protein OTX2 (OTX2)

Product Description

Recombinant Human Homeobox protein OTX2 (OTX2) is available at Gentaur for Next week Delivery.

Gene Name: OTX2

Alternative Names : Orthodenticle homolog 2

Expression Region : 1-297aa

AA Sequence : MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 48.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.

Function : Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence (BTS)

Involvement in disease : Microphthalmia, syndromic, 5 (MCOPS5); Pituitary hormone deficiency, combined, 6 (CPHD6); Retinal dystrophy, early-onset, with or without pituitary dysfunction (RDEOP)

Subcellular location : Nucleus

Protein Families : Paired homeobox family, Bicoid subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P32243