Recombinant Human Homeobox protein TGIF2LX (TGIF2LX)

Product Description

Recombinant Human Homeobox protein TGIF2LX (TGIF2LX) is available at Gentaur for Next week Delivery.

Gene Name: TGIF2LX

Alternative Names : TGF-beta-induced transcription factor 2-like protein;TGFB-induced factor 2-like protein, X-linkedTGIF-like on the X

Expression Region : 1-241aa

AA Sequence : MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 42.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transcription

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May have a transcription role in testis.

Function : May have a transcription role in testis.

Involvement in disease :

Subcellular location : Nucleus

Protein Families : TALE/TGIF homeobox family

Tissue Specificity : Specifically expressed in adult testis.

Paythway :

Uniprot ID : Q8IUE1