Product Description
Recombinant Human Homeobox protein VENTX (VENTX) is available at Gentaur for Next week Delivery.
Gene Name: VENTX
Alternative Names : May be involved in ventralization.
Expression Region : 1-258aa
AA Sequence : MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 54.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : VENT homeobox homolog VENT-like homeobox protein 2
Function : May be involved in ventralization.
Involvement in disease :
Subcellular location : Nucleus
Protein Families :
Tissue Specificity : Expressed in bone marrow of patients recovering from chemotherapy. Also expressed in an erythroleukemia cell line.
Paythway :
Uniprot ID : O95231