Recombinant Human Homogentisate 1,2-dioxygenase (HGD)

Product Description

Recombinant Human Homogentisate 1,2-dioxygenase (HGD) is available at Gentaur for Next week Delivery.

Gene Name: HGD

Alternative Names : Homogentisate oxygenase Homogentisic acid oxidase Homogentisicase

Expression Region : 1-445aa

AA Sequence : MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 54 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease : Alkaptonuria (AKU)

Subcellular location :

Protein Families : Homogentisate dioxygenase family

Tissue Specificity : Highest expression in the prostate, small intestine, colon, kidney and liver.

Paythway :

Uniprot ID : Q93099