Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1)

Product Description

Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1) is available at Gentaur for Next week Delivery.

Gene Name: HAPLN1

Alternative Names : Cartilage-linking protein 1 Short name: Cartilage-link protein Proteoglycan link protein CRTL1

Expression Region : 16-354aa

AA Sequence : DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged

Theoretical MW : 44.0 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.

Function : Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.

Involvement in disease :

Subcellular location : Secreted, extracellular space, extracellular matrix

Protein Families : HAPLN family

Tissue Specificity : Widely expressed. Weakly expressed in the brain.

Paythway :

Uniprot ID : P10915