Recombinant Human IgG receptor FcRn large subunit p51 (FCGRT), partial

Product Description

Recombinant Human IgG receptor FcRn large subunit p51 (FCGRT), partial is available at Gentaur for Next week Delivery.

Gene Name: FCGRT

Alternative Names : IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor

Expression Region : 24-297aa

AA Sequence : AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 34.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus.

Function : Binds to the Fc region of monomeric immunoglobulins gamma

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein

Protein Families : Immunoglobulin superfamily

Tissue Specificity : Expressed in full-term placenta, heart, lung, liver, muscle, kidney, pancreas, and both fetal and adult small intestine.

Paythway :

Uniprot ID : P55899