Recombinant Human Immunity-related GTPase family M protein (IRGM)

Product Description

Recombinant Human Immunity-related GTPase family M protein (IRGM) is available at Gentaur for Next week Delivery.

Gene Name: IRGM

Alternative Names : Immunity-related GTPase family M protein 1 Interferon-inducible protein 1 LPS-stimulated RAW 264.7 macrophage protein 47 homolog

Expression Region : 1-181aa

AA Sequence : MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 47.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility

Function : Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility (By similarity).

Involvement in disease : Inflammatory bowel disease 19 (IBD19)

Subcellular location : Golgi apparatus membrane, Cell membrane, Cytoplasmic vesicle, phagosome membrane, Cytoplasmic vesicle, autophagosome membrane, Cell projection, phagocytic cup

Protein Families : TRAFAC class dynamin-like GTPase superfamily, IRG family

Tissue Specificity : Widely expressed (at protein level). Expressed in several tissues including colon, small bowel and peripheral blood leukocytes.

Paythway :

Uniprot ID : A1A4Y4