Product Description
Recombinant Human immunodeficiency virus type 1 group M subtype K Protein Vpr (vpr) is available at Gentaur for Next week Delivery.
Gene Name: vpr
Alternative Names : R ORF protein (Viral protein R)
Expression Region : 1-96aa
AA Sequence : MEQAPEDQGPQREPNNEWTLEILEELKREAVRHFPRPWLHNLGQHIYTTYGDTWEGLEAIIRILQQLLFIHFRIGCHHSRIGIIPQRRGRNGSSRS
Sequence Info : Full Length
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 18.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : During virus replication, may deplete host UNG protein, and incude G2-M cell cycle arrest. Acts by targeting specific host proteins for degradation by the 26S proteasome, through association with the cellular CUL4A-DDB1 E3 ligase complex by direct interaction with host VPRPB/DCAF-1. Cell cycle arrest reportedly occurs within hours of infection and is not blocked by antiviral agents, suggesting that it is initiated by the VPR carried into the virion. Additionally, VPR induces apoptosis in a cell cycle dependent manner suggesting that these two effects are mechanistically linked. Detected in the serum and cerebrospinal fluid of AIDS patient, VPR may also induce cell death to bystander cells.During virus entry, plays a role in the transport of the viral pre-integration complex to the host nucleus. This function is crucial for viral infection of non-dividing macrophages. May act directly at the nuclear pore complex, by binding nucleoporins phenylalanine-glycine-repeat regions.
Function : During virus replication, may deplete host UNG protein, and incude G2-M cell cycle arrest. Acts by targeting specific host proteins for degradation by the 26S proteasome, through association with the cellular CUL4A-DDB1 E3 ligase complex by direct interaction with host VPRPB/DCAF-1. Cell cycle arrest reportedly occurs within hours of infection and is not blocked by antiviral agents, suggesting that it is initiated by the VPR carried into the virion. Additionally, VPR induces apoptosis in a cell cycle dependent manner suggesting that these two effects are mechanistically linked. Detected in the serum and cerebrospinal fluid of AIDS patient, VPR may also induce cell death to bystander cells.
Involvement in disease :
Subcellular location : Virion, Host nucleus, Host extracellular space
Protein Families : HIV-1 VPR protein family
Tissue Specificity :
Paythway :
Uniprot ID : P0C1P2
Euro
British Pound
US Dollar