Product Description
Recombinant Human Immunoglobulin iota chain (VPREB1) is available at Gentaur for Next week Delivery.
Gene Name: VPREB1
Alternative Names : CD179 antigen-like family member A Protein VPreB1 V(pre)B protein Short name:VpreB protein CD_antigen: CD179a
Expression Region : 20-145aa
AA Sequence : QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAARTRVP
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 30.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation.
Function : Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation.
Involvement in disease :
Subcellular location :
Protein Families : Immunoglobulin superfamily
Tissue Specificity : Only expressed by pre-B-cells.
Paythway :
Uniprot ID : P12018
Euro
British Pound
US Dollar