Recombinant Human Immunoglobulin iota chain (VPREB1)

Product Description

Recombinant Human Immunoglobulin iota chain (VPREB1) is available at Gentaur for Next week Delivery.

Gene Name: VPREB1

Alternative Names : CD179 antigen-like family member A Protein VPreB1 V(pre)B protein Short name:VpreB protein CD_antigen: CD179a

Expression Region : 20-145aa

AA Sequence : QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAARTRVP

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 30.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation.

Function : Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation.

Involvement in disease :

Subcellular location :

Protein Families : Immunoglobulin superfamily

Tissue Specificity : Only expressed by pre-B-cells.

Paythway :

Uniprot ID : P12018