Recombinant Human Insulin-like growth factor I (IGF1), partial (Active)

Product Description

Recombinant Human Insulin-like growth factor I (IGF1), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: IGF1

Alternative Names : Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1

Expression Region : 52-118aa

AA Sequence : TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Sequence Info : Partial

Tag Info : Tag-Free

Theoretical MW : 7.3 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 20 mM NaAc-HAC, pH 4.5

Endotoxin Level : Less than 0.5 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a serum-free cell proliferation assay using MCF?7 human breast cancer cells is typically 1-8 ng/mL

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Insulin-like growth factor I (IGF1) belongs to the family of insulin-like growth factors that are structurally homologous to proinsulin. Mature IGFs are generated by proteolytic processing of inactive precursor protein containing N-terminal and C-terminal propeptide regions. Mature human IGF-I consisting of 70 amino acids with 94% identity with mouse IGF1 and exhibits cross-species activity. IGF1 binds IGF-1R, IGF-2R, and the insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression. IGF1 expression is regulated by growth hormone.

Function : The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation

Involvement in disease : Insulin-like growth factor I deficiency (IGF1 deficiency)

Subcellular location : Secreted

Protein Families : Insulin family

Tissue Specificity :

Paythway : HIF-1signalingpathway

Uniprot ID : P05019