Recombinant Human Integrin alpha-V (ITGAV), partial

Product Description

Recombinant Human Integrin alpha-V (ITGAV), partial is available at Gentaur for Next week Delivery.

Gene Name: ITGAV

Alternative Names : Vitronectin receptor subunit alpha; CD51

Expression Region : 891-1048aa

AA Sequence : DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 19.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. In case of HIV-1 infection, the interaction with Extracellular domain viral Tat protein ses to enhance angiogenesis in Kaposi's sarcoma lesions.

Function : The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. ITGAV

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein, Cell junction, focal adhesion

Protein Families : Integrin alpha chain family

Tissue Specificity :

Paythway : PI3K-Aktsignalingpathway

Uniprot ID : P06756