Recombinant Human Integrin-linked protein kinase (ILK), partial

Product Description

Recombinant Human Integrin-linked protein kinase (ILK), partial is available at Gentaur for Next week Delivery.

Gene Name: ILK

Alternative Names : 59KDA serine/threonine-protein kinaseILK-1ILK-2p59ILK

Expression Region : 1-228aa

AA Sequence : MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWS

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 30 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor-proximal protein kinase regulating integrin-mediated signal transduction. May act as a mediator of inside-out integrin signaling. Focal adhesion protein part of the complex ILK-PINCH. This complex is considered to be one of the convergence points of integrin- and growth factor-signaling pathway. Could be implicated in mediating cell architecture, adhesion to integrin substrates and anchorage-dependent growth in epithelial cells. Phosphorylates beta-1 and beta-3 integrin subunit on serine and threonine residues, but also AKT1 and GSK3B.

Function : Receptor-proximal protein kinase regulating integrin-mediated signal transduction

Involvement in disease :

Subcellular location : Cell junction, focal adhesion, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, lamellipodium, Cytoplasm, myofibril, sarcomere

Protein Families : Protein kinase superfamily, TKL Ser/Thr protein kinase family

Tissue Specificity : Highly expressed in heart followed by skeletal muscle, pancreas and kidney. Weakly expressed in placenta, lung and liver.

Paythway : PPARsignalingpathway

Uniprot ID : Q13418