Product Description
Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4)?partial is available at Gentaur for Next week Delivery.
Gene Name: ITIH4
Alternative Names : Inter-alpha-trypsin inhibitor family heavy chain-related protein
Expression Region : 689-930aa
AA Sequence : RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 28.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
Function : Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
Involvement in disease :
Subcellular location : Secreted
Protein Families : ITIH family
Tissue Specificity : Liver specific.
Paythway :
Uniprot ID : Q14624
Euro
British Pound
US Dollar