Euro
British Pound
US Dollar
Product Description
Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), partial is available at Gentaur for Next week Delivery.
Gene Name: ITIH5
Alternative Names :
Expression Region : 35-161aa
AA Sequence : VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 30.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May act as a tumor suppressor.
Function : May act as a tumor suppressor.
Involvement in disease :
Subcellular location : Secreted
Protein Families : ITIH family
Tissue Specificity : Abundantly expressed in placenta. Less abundant expression in mammary gland and ovary. Expression is barely detectable levels in all other tissues tested.
Paythway :
Uniprot ID : Q86UX2
