Product Description
Recombinant Human Interferon alpha-2 (IFNA2) (Active) is available at Gentaur for Next week Delivery.
Gene Name: IFNA2
Alternative Names : Interferon Alpha-2; IFN-Alpha-2; Interferon Alpha-A; LeIF A; IFNA2
Expression Region : 24-188aa
AA Sequence : CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Sequence Info : Full Length of Mature Protein
Tag Info : Tag-Free
Theoretical MW : 19.24 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.2
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined by a viral resistance assay using VSV-WISH cells is typically 10 pg/mL.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : At least 23 different variants of IFN-? are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-? subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN-? subtypes only differ in their sequences by one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxy-terminal end.
Function : Produced by macrophages, IFN-alpha have antiviral activities.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Alpha/beta interferon family
Tissue Specificity :
Paythway : Jak-STATsignalingpathway
Uniprot ID : P01563
 Euro
            
 British Pound
            
 US Dollar