Recombinant Human Interferon alpha-21 (IFNA21)

Product Description

Recombinant Human Interferon alpha-21 (IFNA21) is available at Gentaur for Next week Delivery.

Gene Name: IFNA21

Alternative Names : Interferon alpha-F;LeIF F

Expression Region : 24-189aa

AA Sequence : CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 21.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Function : Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes

Involvement in disease :

Subcellular location : Secreted

Protein Families : Alpha/beta interferon family

Tissue Specificity :

Paythway : Jak-STATsignalingpathway

Uniprot ID : P01568