Euro
British Pound
US Dollar
Product Description
Recombinant Human Interferon beta protein (IFNB1) is available at Gentaur for Next week Delivery.
Gene Name: IFNB1
Alternative Names : Fibroblast interferon
Expression Region : 22-187aa
AA Sequence : MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal GST-tagged
Theoretical MW : 47 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Has antiviral, antibacterial and anticancer activities.
Function : Has antiviral, antibacterial and anticancer activities.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Alpha/beta interferon family
Tissue Specificity :
Paythway : Jak-STATsignalingpathway
Uniprot ID : P01574
