Recombinant Human Interleukin-1 alpha (IL1A) (Active)

Product Description

Recombinant Human Interleukin-1 alpha (IL1A) (Active) is available at Gentaur for Next week Delivery.

Gene Name: IL1A

Alternative Names : Interleukin-1 Alpha; IL-1 Alpha; Hematopoietin-1; IL1A; IL1F1

Expression Region : 113-271aa

AA Sequence : SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 18 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to induce NFKB reporter gene expression in HEK 293 cell line is less than 50 pg/mL.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Interleukin-1 alpha (IL1?) is a cytokine member of the interleukin-1 family. IL-1 consists of two distinct forms: IL1? and IL1? that recognize the same cell surface receptors but are distinct proteins with approximately 25% amino acid sequence identity. IL1? is constitutively produced by epithelial cells and plays an essential role in maintenance of skin barrier function. Upon stimulation, a wide variety of cells including osteoblasts, monocytes, macrophages can be induced to express IL1?. IL1? possesses a wide range of metabolic, physiological, haematopoietic activities, and is critically involved in the regulation of the immune responses and inflammatory responses.

Function : Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Involvement in disease :

Subcellular location : Secreted

Protein Families : IL-1 family

Tissue Specificity :

Paythway : MAPKsignalingpathway

Uniprot ID : P01583