Recombinant Human Interleukin-1 beta (IL1B) (Active)

Product Description

Recombinant Human Interleukin-1 beta (IL1B) (Active) is available at Gentaur for Next week Delivery.

Gene Name: IL1B

Alternative Names : Interleukin-1 beta; Catabolin; IL1F2; IL1B.

Expression Region : 117-269aa

AA Sequence : APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 17.5 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to induce NFKB reporter gene expression in HEK 293 cell line is typically 142 pg/mL

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : IL1B belongs to the IL-1 family. Interleukin 1 (IL-1) is a family of polypeptide cytokines consisting of two agonists, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2) encoded by two distinct genes and perform identical biological functions. IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response. It is identified as endogenous pyrogens, and is reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Function : Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells.

Involvement in disease :

Subcellular location : Cytoplasm, cytosol, Lysosome, Secreted, exosome, Secreted

Protein Families : IL-1 family

Tissue Specificity : Expressed in activated monocytes/macrophages (at protein level).

Paythway : MAPKsignalingpathway

Uniprot ID : P01584