Recombinant Human Interleukin-11 (IL11), partial (Active)

Product Description

Recombinant Human Interleukin-11 (IL11), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: IL11

Alternative Names : Interleukin-11; IL-11; Adipogenesis Inhibitory Factor; AGIF; Oprelvekin; IL11

Expression Region : 23-199aa

AA Sequence : GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Sequence Info : Partial

Tag Info : Tag-Free

Theoretical MW : 19 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 2% Glycine, pH 7.2

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cell proliferation assay using murine 7TD1 cells is typically 0.2 ng/mL

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Interleukin 11 (IL-11) is a member of a family of human growth factors that includes human growth hormone, granulocyte colony-stimulating factor, and other growth factors. IL-11 is a thrombopoietic growth factor that directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. It also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2, It activates a signaling cascade that promotes cell proliferation. The signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3.

Function : Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production

Involvement in disease :

Subcellular location : Secreted

Protein Families : IL-6 superfamily

Tissue Specificity :

Paythway : Jak-STATsignalingpathway

Uniprot ID : P20809