Recombinant Human Interleukin-17A (IL17A) (Active)

Product Description

Recombinant Human Interleukin-17A (IL17A) (Active) is available at Gentaur for Next week Delivery.

Gene Name: IL17A

Alternative Names : Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17

Expression Region : 24-155aa

AA Sequence : GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Sequence Info : Full Length of Mature Protein

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 20.5 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to induce IL-6 secretion by NIH?3T3 mouse embryonic fibroblast cells is less than 500 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. As IL-17 shares properties with IL-1 and TNF-alpha, it may induce joint inflammation and bone and cartilage destruction. This cytokine is found in synovial fluids of patients with rheumatoid arthritis, and produced by rheumatoid arthritis synovium. It increases IL-6 production, induces collagen degradation and decreases collagen synthesis by synovium and cartilage and proteoglycan synthesis in cartilage. IL-17 is also able to increase bone destruction and reduce its formation. Blocking of interleukin-17 with specific inhibitors provides a protective inhibition of cartilage and bone degradation.

Function : Ligand for IL17RA and IL17RC

Involvement in disease :

Subcellular location : Secreted

Protein Families : IL-17 family

Tissue Specificity : Restricted to activated memory T-cells.

Paythway : IL-17signalingpathway

Uniprot ID : Q16552