Recombinant Human Interleukin-18-binding protein (IL18BP), partial

Product Description

Recombinant Human Interleukin-18-binding protein (IL18BP), partial is available at Gentaur for Next week Delivery.

Gene Name: IL18BP

Alternative Names : Tadekinig-alfa

Expression Region : 31-183aa

AA Sequence : TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEAL

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 20.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.

Function : Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.

Involvement in disease :

Subcellular location : Secreted

Protein Families :

Tissue Specificity : Strongly expressed in heart, lung, placenta and spleen.

Paythway :

Uniprot ID : O95998