Recombinant Human Interleukin-20 receptor subunit alpha (IL20RA), partial (Active)

Product Description

Recombinant Human Interleukin-20 receptor subunit alpha (IL20RA), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: IL20RA

Alternative Names : Interleukin-20 Receptor Subunit Alpha; IL-20 Receptor Subunit Alpha; IL-20R-Alpha; IL-20RA; Cytokine Receptor Class-II Member 8; Cytokine Receptor Family 2 Member 8; CRF2-8; IL-20R1; ZcytoR7; IL20RA

Expression Region : 30-250aa

AA Sequence : VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLKYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQPSEKQCARTLKDQSSEFKAK

Sequence Info : Partial

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 26.3 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to bind Human IL-20 in functional ELISA is less than 10 ug/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Interleukin-20 Receptor Subunit ? (IL20RA) is a single-pass type I membrane protein that is a member of the type II cytokine receptor family. IL20RA is synthetized a 553 amino acid glycoprotein precursor containing a 29 amino acid signal peptide, a 221 amino acid extracellular domain with two fibronectin type-III domains, a 24 amino acid transmembrane region, and a 279 amino acid intracellular domain. IL20RA is widely expressed with highest levels found in skin and testis and high levels in brain. IL20RA forms a heterodimer with IL20RB, and the complex serves as a receptor for IL19, IL20 and IL24. IL20RA also forms a heterodimer with the unique and specific receptor IL10RB and functions as the receptor for IL26.

Function : The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26.

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families : Type II cytokine receptor family

Tissue Specificity : Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin.

Paythway : Jak-STATsignalingpathway

Uniprot ID : Q9UHF4