Recombinant Human Interleukin-22 (IL22), partial (Active)

Product Description

Recombinant Human Interleukin-22 (IL22), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: IL22

Alternative Names : Interleukin-22;IL-22;Cytokine Zcyto18;IL-10-related T-cell-derived-inducible factor;IL-TIF; IL22;ILTIF; ZCYTO18

Expression Region : 34-179aa

AA Sequence : APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Sequence Info : Partial

Tag Info : Tag-Free

Theoretical MW : 16.9 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells is less than 1 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Interleukin-22(IL-22) is a member of a group of the IL-10 family, a class of potent mediators of cellular inflammatory responses. IL-22 is produced by activated DC and T cells. IL-22 and IL-10 receptor chains play a role in cellular targeting and signal transduction. It can initiate and regulate innate immune responses against bacterial pathogens especially in epithelial cells such as respiratory and gut epithelial cells. IL-22 along with IL-17 likely plays a role in the coordinated response of both adaptive and innate immune systems. IL-22 also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. Biological activity of IL-22 is initiated by binding to a cell-surface complex consisting of IL-22R1 and IL-10R2 receptor chains. IL-22 biological activity is further regulated by interactions with a soluble binding protein, IL-22BP. IL-22BP and an extracellular region of IL-22R1 share sequence similarity. In some cases, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by cytokine IL-17A.

Function : Cytokine that contributes to the inflammatory response in vivo.

Involvement in disease :

Subcellular location : Secreted

Protein Families : IL-10 family

Tissue Specificity :

Paythway : Jak-STATsignalingpathway

Uniprot ID : Q9GZX6