Recombinant Human Interleukin-3 (IL3)

Product Description

Recombinant Human Interleukin-3 (IL3) is available at Gentaur for Next week Delivery.

Gene Name: IL3

Alternative Names : Hematopoietic growth factor Mast cell growth factor

Expression Region : 20-152aa

AA Sequence : APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Sequence Info : Full Length of Mature Protein

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 17.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.

Function : Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION

Involvement in disease :

Subcellular location : Secreted

Protein Families : IL-3 family

Tissue Specificity : Activated T-cells, mast cells, natural killer cells.

Paythway : Jak-STATsignalingpathway

Uniprot ID : P08700