Product Description
Recombinant Human Interleukin-3 (IL3) (Active) is available at Gentaur for Next week Delivery.
Gene Name: IL3
Alternative Names : Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3
Expression Region : 20-152aa
AA Sequence : APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 16.6 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 0.5 ng/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Interleukin-3 (IL-3) is a potent growth promoting cytokine. IL-3 can stimulate the proliferation and differentiation of pluripotent hematopoietic stem cells as well as various lineage committed progenitors. IL-3 exerts its biological function through binding to specific cell surface receptors. The amino acid sequences of this protein among different species share relatively low identity and its activity is highly species-specific. IL-3 has also been shown to possess neurotrophic activity, and is thought to be associated with neurologic disorders.
Function : Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION
Involvement in disease :
Subcellular location : Secreted
Protein Families : IL-3 family
Tissue Specificity : Activated T-cells, mast cells, natural killer cells.
Paythway : Jak-STATsignalingpathway
Uniprot ID : P08700
Euro
British Pound
US Dollar