Recombinant Human Interleukin-36 gamma (IL36G) (Active)

Product Description

Recombinant Human Interleukin-36 gamma (IL36G) (Active) is available at Gentaur for Next week Delivery.

Gene Name: IL36G

Alternative Names : Interleukin-36 gamma; IL36G; IL-1-related protein 2; IL-1RP2; IL-1 epsilon; IL-1F9; Interleukin-1 homolog 1; IL-1H1

Expression Region : 18-169aa

AA Sequence : SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 17 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM EDTA, pH 8.0

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells is less than 20 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Interleukin-36 gamma (IL-36?) is a member of the interleukin 1 cytokine family that includes three closely related genes, IL-36?, ?, and ?, formerly known as IL-1F6, F8, and F9 respectively. IL-36? has been detected in both neuronal and synovial tissue, whereas IL-36? and IL-36? are expressed in both cutaneous and mucosal epithelial cells, including the respiratory tract. IL-36? and IL-36? stimulate proliferation, maturation and/or cytokine expression by innate immune cells (such as keratinocytes and dendritic cells), and adaptive immune cells (neutrophils and T-cells) in both humans and mice. The activity of IL-36? is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). IL-36? plays an important role in communicating the cell death to surrounding cells.

Function : Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. In cultured keratinocytes induces the expression of macrophage, T-cell, and neutrophil chemokines, such as CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20 and CXCL1; also stimulates its own expression and that of the prototypic cutaneous proinflammatory parameters TNF-alpha, S100A7/psoriasin and inducible NOS. May play a role in proinflammatory responses during particular neutrophilic airway inflammation

Involvement in disease :

Subcellular location : Secreted

Protein Families : IL-1 family

Tissue Specificity : Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. Expressed in bronchial epithelial. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin. Expressed in monocyte-derived dendritic cells and M1 macrophages.

Paythway :

Uniprot ID : Q9NZH8