Recombinant Human Interstitial collagenase (MMP1), partial

Product Description

Recombinant Human Interstitial collagenase (MMP1), partial is available at Gentaur for Next week Delivery.

Gene Name: MMP1

Alternative Names : Fibroblast collagenase;Matrix metalloproteinase-1;MMP-1

Expression Region : 101-469aa

AA Sequence : VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 46.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Developmental Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity.

Function : Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X

Involvement in disease :

Subcellular location : Secreted, extracellular space, extracellular matrix

Protein Families : Peptidase M10A family

Tissue Specificity :

Paythway : PPARsignalingpathway

Uniprot ID : P03956