Recombinant Human Islet cell autoantigen 1 (ICA1), partial

Product Description

Recombinant Human Islet cell autoantigen 1 (ICA1), partial is available at Gentaur for Next week Delivery.

Gene Name: ICA1

Alternative Names : 69KDA islet cell autoantigen;ICA69Islet cell autoantigen p69;ICAp69;p69

Expression Region : 1-268aa

AA Sequence : MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 35.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in neurotransmitter secretion.

Function : May play a role in neurotransmitter secretion.

Involvement in disease :

Subcellular location : Cytoplasm, cytosol, Golgi apparatus membrane, Peripheral membrane protein, Cytoplasmic vesicle, secretory vesicle membrane, Peripheral membrane protein, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Peripheral membrane protein

Protein Families :

Tissue Specificity : Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid.

Paythway :

Uniprot ID : Q05084