Product Description
Recombinant Human Islet cell autoantigen 1 (ICA1), partial is available at Gentaur for Next week Delivery.
Gene Name: ICA1
Alternative Names : 69KDA islet cell autoantigen;ICA69Islet cell autoantigen p69;ICAp69;p69
Expression Region : 1-268aa
AA Sequence : MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTSHTMAAIHESFKGYQPYEFTTLK
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 35.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May play a role in neurotransmitter secretion.
Function : May play a role in neurotransmitter secretion.
Involvement in disease :
Subcellular location : Cytoplasm, cytosol, Golgi apparatus membrane, Peripheral membrane protein, Cytoplasmic vesicle, secretory vesicle membrane, Peripheral membrane protein, Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Peripheral membrane protein
Protein Families :
Tissue Specificity : Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid.
Paythway :
Uniprot ID : Q05084
Euro
British Pound
US Dollar