Recombinant Human Kallikrein-10 (KLK10), partial

Product Description

Recombinant Human Kallikrein-10 (KLK10), partial is available at Gentaur for Next week Delivery.

Gene Name: KLK10

Alternative Names : Normal epithelial cell-specific 1;Protease serine-like 1

Expression Region : 31-274aa

AA Sequence : AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIR

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 30.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Cycle

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Has a tumor-suppressor role for NES1 in breast and prostate cancer.

Function : Has a tumor-suppressor role for NES1 in breast and prostate cancer.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Peptidase S1 family, Kallikrein subfamily

Tissue Specificity : Expressed in breast, ovary and prostate.

Paythway :

Uniprot ID : O43240