Recombinant Human KeRatin, type I cytoskeletal 10 (KRT10), partial

Product Description

Recombinant Human KeRatin, type I cytoskeletal 10 (KRT10), partial is available at Gentaur for Next week Delivery.

Gene Name: KRT10

Alternative Names : Cytokeratin-10;CK-10Keratin-10;K10

Expression Region : 326-443aa

AA Sequence : EQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLE

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 15.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease : Epidermolytic hyperkeratosis (EHK); Ichthyosis annular epidermolytic (AEI); Erythroderma, ichthyosiform, congenital reticular (CRIE)

Subcellular location :

Protein Families : Intermediate filament family

Tissue Specificity : Seen in all suprabasal cell layers including stratum corneum.

Paythway : Estrogensignalingpathway

Uniprot ID : P13645