Product Description
Recombinant Human Keratinocyte growth factor (FGF7), partial is available at Gentaur for Next week Delivery.
Gene Name: FGF7
Alternative Names : Heparin-binding growth factor 7
Expression Region : 34-189aa
AA Sequence : DMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFL
Sequence Info : Partial
Tag Info : N-terminal 6xHis-B2M-tagged
Theoretical MW : 32.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
Function : Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Heparin-binding growth factors family
Tissue Specificity : Epithelial cell.
Paythway : MAPKsignalingpathway
Uniprot ID : P21781
Euro
British Pound
US Dollar