Recombinant Human Ketohexokinase (KHK)

Product Description

Recombinant Human Ketohexokinase (KHK) is available at Gentaur for Next week Delivery.

Gene Name: KHK

Alternative Names : Hepatic fructokinase

Expression Region : 1-298aa

AA Sequence : MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal GST-tagged

Theoretical MW : 59.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the phosphorylation of the ketose sugar fructose to fructose-1-phosphate.

Function : Catalyzes the phosphorylation of the ketose sugar fructose to fructose-1-phosphate.

Involvement in disease : Fructosuria (FRUCT)

Subcellular location :

Protein Families : Carbohydrate kinase PfkB family

Tissue Specificity : Most abundant in liver, kidney, gut, spleen and pancreas. Low levels also found in adrenal, muscle, brain and eye.

Paythway :

Uniprot ID : P50053