Recombinant Human Kidney mitochondrial carrier protein 1 (SLC25A30)

Product Description

Recombinant Human Kidney mitochondrial carrier protein 1 (SLC25A30) is available at Gentaur for Next week Delivery.

Gene Name: SLC25A30

Alternative Names : Solute carrier family 25 member 30

Expression Region : 1-291aa

AA Sequence : MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSNTIQGGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCSGYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFVTYEQLKKLDL

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 48.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Probable transporter.

Function : Probable transporter.

Involvement in disease :

Subcellular location : Mitochondrion inner membrane, Multi-pass membrane protein

Protein Families : Mitochondrial carrier (TC 2.A.29) family

Tissue Specificity :

Paythway :

Uniprot ID : Q5SVS4