Product Description
Recombinant Human Kidney mitochondrial carrier protein 1 (SLC25A30) is available at Gentaur for Next week Delivery.
Gene Name: SLC25A30
Alternative Names : Solute carrier family 25 member 30
Expression Region : 1-291aa
AA Sequence : MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSNTIQGGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCSGYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFVTYEQLKKLDL
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 48.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Probable transporter.
Function : Probable transporter.
Involvement in disease :
Subcellular location : Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families : Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity :
Paythway :
Uniprot ID : Q5SVS4
Euro
British Pound
US Dollar