Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial

Product Description

Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial is available at Gentaur for Next week Delivery.

Gene Name: KIR2DS3

Alternative Names : MHC class I NK cell receptor Natural killer-associated transcript 7 NKAT7

Expression Region : 22-245aa

AA Sequence : HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 26.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

Function : Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein

Protein Families : Immunoglobulin superfamily

Tissue Specificity :

Paythway : Antigenprocessingandpresentation

Uniprot ID : Q14952