Recombinant Human Killer cell lectin-like receptor subfamily G member 1 (KLRG1), partial

Product Description

Recombinant Human Killer cell lectin-like receptor subfamily G member 1 (KLRG1), partial is available at Gentaur for Next week Delivery.

Gene Name: KLRG1

Alternative Names : C-type lectin domain family 15 member AITIM-containing receptor MAFA-LMAFA-like receptorMast cell function-associated antigen

Expression Region : 60-195aa

AA Sequence : LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 31.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells.

Function : Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells.

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type II membrane protein

Protein Families :

Tissue Specificity : Expressed specifically on natural killer (NK) cells and T-cells, mainly CD8 T-cells.

Paythway :

Uniprot ID : Q96E93