Product Description
Recombinant Human Kinase suppressor of Ras 1 (KSR1), partial is available at Gentaur for Next week Delivery.
Gene Name: KSR1
Alternative Names : KSR
Expression Region : 404-598aa
AA Sequence : TESVPSDINNPVDRAAEPHFGTLPKALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPVPSAGHCWKCLLIAESLKENAFNISAFAHAAPLPEAADGTRLDDQPKADVLEAHEAEAEEPEAGKSEAEDDEDEVDDLPSSRRPWRGPISRKASQ
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 25.0 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Scaffolding protein that is part of a multiprotein signaling complex. Promotes phosphorylation of Raf family members and activation of downstream MAP kinases. Promotes activation of MAPK1 and/or MAPK3, both in response to EGF and to cAMP. Does not have kinase activity by itself.
Function : Scaffolding protein that is part of a multiprotein signaling complex. Promotes phosphorylation of Raf family members and activation of downstream MAP kinases. Promotes activation of MAPK1 and/or MAPK3, both in response to EGF and to cAMP. Does not have kinase activity by itself.
Involvement in disease :
Subcellular location : Cytoplasm, Membrane, Peripheral membrane protein, Cell membrane, Peripheral membrane protein, Cell projection, ruffle membrane, Endoplasmic reticulum membrane
Protein Families : Protein kinase superfamily, TKL Ser/Thr protein kinase family
Tissue Specificity :
Paythway : Rassignalingpathway
Uniprot ID : Q8IVT5
Euro
British Pound
US Dollar