Recombinant Human L-2-hydroxyglutarate dehydrogenase, mitochondrial (L2HGDH)

Product Description

Recombinant Human L-2-hydroxyglutarate dehydrogenase, mitochondrial (L2HGDH) is available at Gentaur for Next week Delivery.

Gene Name: L2HGDH

Alternative Names : Duranin

Expression Region : 52-441aa

AA Sequence : VIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKLASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRQVAVRGPSWLWQQPMKVSDNNIYCFLWRCFALLLTGSTCSFK

Sequence Info : Full Length of Mature Protein of Isoform 2

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 59.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease : L-2-hydroxyglutaric aciduria (L2HGA)

Subcellular location : Mitochondrion

Protein Families : L2HGDH family

Tissue Specificity : Widely expressed. Highly expressed in brain, testis and muscle. Expressed to a lower extent in lymphocytes, fibroblasts, keratinocytes, placenta, bladder, small intestine, liver and bone marrow.

Paythway :

Uniprot ID : Q9H9P8