Recombinant Human L-lactate dehydrogenase A chain (LDHA), partial

Product Description

Recombinant Human L-lactate dehydrogenase A chain (LDHA), partial is available at Gentaur for Next week Delivery.

Gene Name: LDHA

Alternative Names : Cell proliferation-inducing gene 19 protein;LDH muscle subunit;LDH-MRenal carcinoma antigen NY-REN-59

Expression Region : 5-323aa

AA Sequence : KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 39.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease : Glycogen storage disease 11 (GSD11)

Subcellular location : Cytoplasm

Protein Families : LDH/MDH superfamily, LDH family

Tissue Specificity :

Paythway : HIF-1signalingpathway

Uniprot ID : P00338