Product Description
Recombinant Human La-related protein 1B (LARP1B) is available at Gentaur for Next week Delivery.
Gene Name: LARP1B
Alternative Names : La ribonucleoprotein domain family member 1BLa ribonucleoprotein domain family member 2La-related protein 2
Expression Region : 1-201aa
AA Sequence : MDSRDRGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE
Sequence Info : Full Length of Isoform 7
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 40.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location :
Protein Families : LARP family
Tissue Specificity :
Paythway :
Uniprot ID : Q659C4
Euro
British Pound
US Dollar