Recombinant Human Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF)

Product Description

Recombinant Human Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF) is available at Gentaur for Next week Delivery.

Gene Name: LITAF

Alternative Names : Small integral membrane protein of lysosome/late endosome p53-induced gene 7 protein

Expression Region : 1-161aa

AA Sequence : MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 44.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Probable role in regulating transcription of specific genes. May regulate through NFKB1 the expression of the CCL2/MCP-1 chemokine. May play a role in tumor necrosis factor alpha (TNF-alpha) gene expression.

Function : Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation

Involvement in disease : Charcot-Marie-Tooth disease 1C (CMT1C)

Subcellular location : Cytoplasm, Nucleus, Lysosome membrane, Peripheral membrane protein, Cytoplasmic side, Early endosome membrane, Late endosome membrane, Endosome membrane, Peripheral membrane protein, Cytoplasmic side, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Golgi apparatus membrane

Protein Families : CDIP1/LITAF family

Tissue Specificity : Ubiquitously and abundantly expressed. Expressed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen.

Paythway :

Uniprot ID : Q99732