Recombinant Human Lipopolysaccharide-responsive and beige-like anchor protein (LRBA), partial

Product Description

Recombinant Human Lipopolysaccharide-responsive and beige-like anchor protein (LRBA), partial is available at Gentaur for Next week Delivery.

Gene Name: LRBA

Alternative Names : Beige-like protein;CDC4-like protein

Expression Region : 1-251aa

AA Sequence : MASEDNRVPSPPPTGDDGGGGGREETPTEGGALSLKPGLPIRGIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESINCMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDNMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGRWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 31.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in coupling signal transduction and vesicle trafficking to enable polarized secretion and/or mbrane deposition of immune effector molecules.

Function : May be involved in coupling signal transduction and vesicle trafficking to enable polarized secretion and/or membrane deposition of immune effector molecules.

Involvement in disease : Immunodeficiency, common variable, 8, with autoimmunity (CVID8)

Subcellular location : Cell membrane, Single-pass membrane protein, Endoplasmic reticulum, Golgi apparatus, trans-Golgi network, Lysosome

Protein Families :

Tissue Specificity : Ubiquitous.

Paythway :

Uniprot ID : P50851