Product Description
Recombinant Human Lipopolysaccharide-responsive and beige-like anchor protein (LRBA), partial is available at Gentaur for Next week Delivery.
Gene Name: LRBA
Alternative Names : Beige-like protein;CDC4-like protein
Expression Region : 1-251aa
AA Sequence : MASEDNRVPSPPPTGDDGGGGGREETPTEGGALSLKPGLPIRGIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESINCMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDNMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGRWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDK
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 31.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May be involved in coupling signal transduction and vesicle trafficking to enable polarized secretion and/or mbrane deposition of immune effector molecules.
Function : May be involved in coupling signal transduction and vesicle trafficking to enable polarized secretion and/or membrane deposition of immune effector molecules.
Involvement in disease : Immunodeficiency, common variable, 8, with autoimmunity (CVID8)
Subcellular location : Cell membrane, Single-pass membrane protein, Endoplasmic reticulum, Golgi apparatus, trans-Golgi network, Lysosome
Protein Families :
Tissue Specificity : Ubiquitous.
Paythway :
Uniprot ID : P50851
Euro
British Pound
US Dollar