Recombinant Human Luc7-like protein 3 (LUC7L3), partial

Product Description

Recombinant Human Luc7-like protein 3 (LUC7L3), partial is available at Gentaur for Next week Delivery.

Gene Name: LUC7L3

Alternative Names : Cisplatin resistance-associated-overexpressed protein;Luc7AOkadaic acid-inducible phosphoprotein OA48-18cAMP regulatory element-associated protein 1;CRE-associated protein 1;CREAP-1

Expression Region : 1-79aa

AA Sequence : MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 13.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds cAMP regulatory elent DNA sequence. May play a role in RNA splicing.

Function : Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.

Involvement in disease :

Subcellular location : Nucleus speckle

Protein Families : Luc7 family

Tissue Specificity : Widely expressed. Highest levels in heart, brain, pancreas, thymus, ovary, small intestine and peripheral blood leukocytes, as well as cerebellum, putamen and pituitary gland. Lowest levels in lung, liver and kidney. Also expressed in fetal tissues, including brain, heart, kidney, thymus and lung.

Paythway :

Uniprot ID : O95232