Product Description
Recombinant Human Ly6/PLAUR domain-containing protein 6 (LYPD6) is available at Gentaur for Next week Delivery.
Gene Name: LYPD6
Alternative Names :
Expression Region : 23-171aa
AA Sequence : AQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 18.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function : Acts as a modulator of nicotinic acetylcholine receptors (nAChRs) function in the brain. Inhibits nicotine-induced Ca(2+) influx through nAChRs
Involvement in disease :
Subcellular location : Secreted, Cytoplasm, Cell membrane, Lipid-anchor, GPI-anchor, Cell junction, synapse, synaptosome, Membrane raft
Protein Families :
Tissue Specificity : Ubiquitous. Highly expressed in brain and heart.
Paythway :
Uniprot ID : Q86Y78