Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D)

Product Description

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D) is available at Gentaur for Next week Delivery.

Gene Name: LY6G6D

Alternative Names : Megakaryocyte-enhanced gene transcript 1 protein

Expression Region : 20-104aa

AA Sequence : NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 11.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor, Cell projection, filopodium

Protein Families :

Tissue Specificity : Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen.

Paythway :

Uniprot ID : O95868