Euro
British Pound
US Dollar
Product Description
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial is available at Gentaur for Next week Delivery.
Gene Name: LY6G6D
Alternative Names : Megakaryocyte-enhanced gene transcript 1 protein
Expression Region : 10-104aa
AA Sequence : LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Sequence Info : Partial
Tag Info : N-terminal 10xHis-B2M-JD-tagged
Theoretical MW : 15.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor, Cell projection, filopodium
Protein Families :
Tissue Specificity : Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen.
Paythway :
Uniprot ID : O95868
