Product Description
Recombinant Human Lymphotoxin-alpha (LTA) (Active) is available at Gentaur for Next week Delivery.
Gene Name: LTA
Alternative Names : Lymphotoxin-Alpha; LT-Alpha; TNF-Beta; Tumor Necrosis Factor Ligand Superfamily Member 1; LTA; TNFB; TNFSF1
Expression Region : 35-205aa
AA Sequence : LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Sequence Info : Full Length of Mature Protein
Tag Info : Tag-Free
Theoretical MW : 18.8 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is less than 100 pg/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Tumor Necrosis Factor ? (TNF-?) is a secreted protein belonging to the tumor necrosis factor family. TNF-? binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM in homotrimeric form, binds to TNFRSF3/LTBR in heterotrimeric form with LTB. TNF-? forms heterotrimers with lymphotoxin-beta, which anchors TNF-? to the cell surface. TNF-? mediates the inflammatory, immunostimulatory, and antiviral response, involves in the formation of second lymphoid organs during development, has a role in apoptosis. TNF-? is produced by lymphocytes and cytotoxic for a variety of tumor cells in vitro and in vivo.
Function : Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.
Involvement in disease : Psoriatic arthritis (PSORAS)
Subcellular location : Secreted, Membrane
Protein Families : Tumor necrosis factor family
Tissue Specificity :
Paythway : NF-kappaBsignalingpathway
Uniprot ID : P01374
Euro
British Pound
US Dollar