Recombinant Human Lymphotoxin-alpha (LTA) (Active)

Product Description

Recombinant Human Lymphotoxin-alpha (LTA) (Active) is available at Gentaur for Next week Delivery.

Gene Name: LTA

Alternative Names : Lymphotoxin-Alpha; LT-Alpha; TNF-Beta; Tumor Necrosis Factor Ligand Superfamily Member 1; LTA; TNFB; TNFSF1

Expression Region : 35-205aa

AA Sequence : LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 18.8 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is less than 100 pg/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Tumor Necrosis Factor ? (TNF-?) is a secreted protein belonging to the tumor necrosis factor family. TNF-? binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM in homotrimeric form, binds to TNFRSF3/LTBR in heterotrimeric form with LTB. TNF-? forms heterotrimers with lymphotoxin-beta, which anchors TNF-? to the cell surface. TNF-? mediates the inflammatory, immunostimulatory, and antiviral response, involves in the formation of second lymphoid organs during development, has a role in apoptosis. TNF-? is produced by lymphocytes and cytotoxic for a variety of tumor cells in vitro and in vivo.

Function : Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.

Involvement in disease : Psoriatic arthritis (PSORAS)

Subcellular location : Secreted, Membrane

Protein Families : Tumor necrosis factor family

Tissue Specificity :

Paythway : NF-kappaBsignalingpathway

Uniprot ID : P01374