Recombinant Human m7GpppN-mRNA hydrolase (DCP2)

Product Description

Recombinant Human m7GpppN-mRNA hydrolase (DCP2) is available at Gentaur for Next week Delivery.

Gene Name: DCP2

Alternative Names : Nucleoside diphosphate-linked moiety X motif 20;Nudix motif 20mRNA-decapping enzyme 2;hDpc

Expression Region : 1-385aa

AA Sequence : METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL

Sequence Info : Full Length of isoform 2

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 46.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transcription

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Decapping metalloenzyme that catalyzes the cleavage of the cap structure on mRNAs. Roves the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Plays a role in replication-dependent histone mRNA degradation. Has higher activity towards mRNAs that lack a poly(A) tail. Has no activity towards a cap structure lacking an RNA moiety

Function : Decapping metalloenzyme that catalyzes the cleavage of the cap structure on mRNAs

Involvement in disease :

Subcellular location : Cytoplasm, P-body, Nucleus

Protein Families : Nudix hydrolase family, DCP2 subfamily

Tissue Specificity : Expressed in brain and testis. Not detected in heart (at protein level).

Paythway :

Uniprot ID : Q8IU60